Relational Model

The relational model represents data as relations (tables) of tuples over typed attributes; keys identify tuples uniquely and foreign keys link relations, while integrity constraints keep the data consistent.

Key formulas & points

Skim these first — then read the full notes below.

  • Tuple = row, attribute = column, domain = allowed values
  • NULL means unknown, not zero or empty string
  • Integrity: entity, referential and domain constraints

Topic details

Introduction

This topic covers the theoretical basis of relational databases. You learn relations, tuples, attributes and domains, the hierarchy of superkeys, candidate keys and the primary key, how foreign keys express relationships, and the three integrity constraints.

Key relations & formulas

Formulas (Indian textbook notation)

  • arelationisasubsetofD1×D2××Dna relation is a subset of D_{1} \times D_{2} \times … \times D_{n}

Formulas (Indian textbook notation)

  • candidatekey=minimalsuperkey;theprimarykeyisonechosencandidatecandidate key = minimal superkey; the primary key is one chosen candidate

Formulas (Indian textbook notation)

  • aforeignkeyreferencesaprimarykeyinanotherrelationa foreign key references a primary key in another relation

Notation and sign conventions

Relation 1 —
arelationisasubsetofD1×D2××Dna relation is a subset of D_{1} \times D_{2} \times … \times D_{n}

Formulas (Indian textbook notation)

  • arelationisasubsetofD1×D2××Dna relation is a subset of D_{1} \times D_{2} \times … \times D_{n}
Write this relation with symbols exactly as in Database System Concepts — Korth, Silberschatz & Sudarshan before substituting numbers. Examiners award partial marks for a correct setup even when arithmetic slips.
Relation 2 —
candidatekey=minimalsuperkey;theprimarykeyisonechosencandidatecandidate key = minimal superkey; the primary key is one chosen candidate

Formulas (Indian textbook notation)

  • candidatekey=minimalsuperkey;theprimarykeyisonechosencandidatecandidate key = minimal superkey; the primary key is one chosen candidate
Write this relation with symbols exactly as in Database System Concepts — Korth, Silberschatz & Sudarshan before substituting numbers. Examiners award partial marks for a correct setup even when arithmetic slips.
Relation 3 —
aforeignkeyreferencesaprimarykeyinanotherrelationa foreign key references a primary key in another relation

Formulas (Indian textbook notation)

  • aforeignkeyreferencesaprimarykeyinanotherrelationa foreign key references a primary key in another relation
Write this relation with symbols exactly as in Database System Concepts — Korth, Silberschatz & Sudarshan before substituting numbers. Examiners award partial marks for a correct setup even when arithmetic slips.

Concept in depth

The relational model’s power is its simplicity: all data lives in relations, unordered sets of tuples, and is queried by set-based operations rather than navigation. A superkey is any attribute set that uniquely identifies tuples; a candidate key is a minimal such set, and the chosen one becomes the primary key that entity integrity requires to be non-null and unique. Foreign keys enforce referential integrity — a referencing value must match an existing primary key or be null — which is what keeps relationships consistent. NULL is a deliberate marker for missing or unknown information and behaves specially in comparisons, which is a frequent source of surprises.

Assumptions and validity limits

State assumptions explicitly before using any relation for relational model — steady state, uniform properties, linear elastic material, ideal gas, incompressible flow, etc., as applicable.
Wrong assumptions invalidate the entire solution even when the formula is correct. In Database Systems viva and GATE descriptive questions, listing valid assumptions often earns separate marks.

Step-by-step problem approach

1. Read the question and list given data with SI units (common in Database Systems papers).
2. Draw a neat labelled diagram where applicable — examiners in Indian universities award diagram marks even when arithmetic slips.
3. Identify which relation from this topic applies to relational model.
4. Use equation 1:
arelationisasubsetofD1×D2××Dna relation is a subset of D_{1} \times D_{2} \times … \times D_{n}
.
5. Use equation 2:
candidatekey=minimalsuperkey;theprimarykeyisonechosencandidatecandidate key = minimal superkey; the primary key is one chosen candidate
.
6. Substitute values, compute, and verify units and sign (direction).
7. State conclusion in one line — e.g. safe/unsafe, stable/unstable, feasible/infeasible.

Applications & exam relevance

Relational Model appears in enterprise applications. In Indian it software curricula this topic is tested because it connects theory to relational model and SQL.
GATE and semester exams often combine relational model with earlier units — revise prerequisites before attempting mixed problems.
Industry interview panels sometimes ask: "Where did you use relational model?" — answer with a lab, mini-project, or plant visit example if possible.

Common mistakes in exams

Students confuse a superkey with a candidate key (candidate keys are minimal), treat NULL as equal to zero or to another NULL, and forget that referential integrity allows a null foreign key. Assuming rows have a guaranteed order is a relational misconception.

Quick revision checklist

Before attempting relational model problems, confirm you can:
1. Tuple = row, attribute = column, domain = allowed values
2. NULL means unknown, not zero or empty string
3. Integrity: entity, referential and domain constraints
Revise the solved examples in Database System Concepts — Korth, Silberschatz & Sudarshan and one previous-year GATE or university paper for this unit.

Worked examples

Try the problem first — open the solution when you are ready to check.

Identifying the primary key

Problem

A relation Student(RollNo, Email, Name) has both RollNo and Email unique. What are the candidate keys and a valid primary key?

Solution

Both RollNo and Email are candidate keys (each minimally and uniquely identifies a student). Either may be chosen as the primary key; RollNo is typical, leaving Email as an alternate key.

Conceptual check — Relational Model

Problem

In a Database Systems semester or GATE paper you are asked: "State the main assumption, the governing relation, and one practical consequence of relational model." What should a complete answer include?

📖 Standard books (India)

  • Database System ConceptsKorth, Silberschatz & Sudarshan

    Read: Syllabus unit

    SQL, normalization, and transactions